PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00258g15027.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family EIL
Protein Properties Length: 351aa    MW: 40611 Da    PI: 4.528
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00258g15027.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3152.55.2e-47311471112
                               XXXXXXXXXXXXXXXXXXXXXXX..XXXXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
                      EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaa.....tgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipek 80 
                               ++lk+rmw d+m++++lke k++     +++     ++   s+  +eq+rrkkmsraQD++LkYM+k+me+c+aqGfvYgi+pek
  Peinf101Scf00258g15027.1  31 DDLKRRMWMDRMRMQKLKEAKREINTCSSSKesqleIDDDDSKAKQEQSRRKKMSRAQDSVLKYMVKIMEICKAQGFVYGIVPEK 115
                               79*****************999844322222345779999999****************************************** PP

                               XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
                      EIN3  81 gkpvegasdsLraWWkekvefdrngpaaisky 112
                               gkpv+g+sdsLr+WWkekv+f++n+p ai++ 
  Peinf101Scf00258g15027.1 116 GKPVTGSSDSLREWWKEKVRFEQNAPSAIAEF 147
                               *****************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048732.1E-4731147No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MVEFQEIVEP LSPMSEVEEN QEVDDEEINY DDLKRRMWMD RMRMQKLKEA KREINTCSSS  60
KESQLEIDDD DSKAKQEQSR RKKMSRAQDS VLKYMVKIME ICKAQGFVYG IVPEKGKPVT  120
GSSDSLREWW KEKVRFEQNA PSAIAEFLPK LDQEKDENLA LVPKNGNNHV NLSGGSTNLR  180
RKEKRKGVFE SDIEMEDVLY AGQNLNCTQS DLEVGFPYKN SRIESETSRP YHEIHTINNQ  240
QSDEQLTLSI NNIPSLIEAQ RIPHEEIMVG NGQNDWMNME IKRSFENYHA QNANGGVENF  300
EGFWGGNIVE QLHYDPVTYG NMNLNDTPQE DVHHHEAPIS VWDLAYEDTS D
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1179185RRKEKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009792280.14e-82PREDICTED: putative ETHYLENE INSENSITIVE 3-like 4 protein
TrEMBLM1BUH11e-107M1BUH1_SOLTU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1573646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10120.12e-46EIL family protein